PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sobic.009G075500.4.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
Family MIKC_MADS
Protein Properties Length: 293aa    MW: 32953.2 Da    PI: 9.8245
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sobic.009G075500.4.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF99.51.4e-3164114151
                           S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
                SRF-TF   1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 
                           krien++nrqvtf+kRrng+lKKA+ELSvLCdaeva+i+fss+g+lyeys+
  Sobic.009G075500.4.p  64 KRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYSN 114
                           79***********************************************95 PP

2K-box83.83.7e-281352337100
                 K-box   7 ks.leeakaeslqqelakLkkeienLq.....reqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqe 89 
                               +e + ++++qe+a+L+++i nLq     +  R l+G d++++s k+L++Le++L+k+l kiR++Kne+l++++e++q++e elq+
  Sobic.009G075500.4.p 135 AGtIAEVTIQHYKQESARLRQQITNLQnsnspQCFRALIG-DITTMSPKDLKHLETRLDKALGKIRARKNEVLCSELEYMQRREMELQN 222
                           335788899******************888777889***9.6*********************************************** PP

                 K-box  90 enkaLrkklee 100
                           +n +Lr++++e
  Sobic.009G075500.4.p 223 DNLYLRSRVDE 233
                           ******99876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006632.21256116IPR002100Transcription factor, MADS-box
SMARTSM004321.5E-3856115IPR002100Transcription factor, MADS-box
CDDcd002658.11E-4457130No hitNo description
SuperFamilySSF554554.58E-3257128IPR002100Transcription factor, MADS-box
PRINTSPR004041.6E-315878IPR002100Transcription factor, MADS-box
PfamPF003191.2E-2665112IPR002100Transcription factor, MADS-box
PRINTSPR004041.6E-317893IPR002100Transcription factor, MADS-box
PRINTSPR004041.6E-3193114IPR002100Transcription factor, MADS-box
PROSITE profilePS5129712.882143237IPR002487Transcription factor, K-box
PfamPF014862.5E-19143231IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 293 aa     Download sequence    Send to blast
MHIREEQAMP STVTGIMVST LTSAGLKLKE PATMSPGGSA SVAAGFGSAA ERNNGRGKGK  60
TEIKRIENTT NRQVTFCKRR NGLLKKAYEL SVLCDAEVAL IVFSSRGRLY EYSNNSVKAT  120
IERYKKANSD NSSAAGTIAE VTIQHYKQES ARLRQQITNL QNSNSPQCFR ALIGDITTMS  180
PKDLKHLETR LDKALGKIRA RKNEVLCSEL EYMQRREMEL QNDNLYLRSR VDENERAQQT  240
VNMMGAPSTS DYQQQGFIPY DPIRSFLQFN IMQQPQFYSQ QEDRKDFNLG GR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1egw_D3e-1957133177MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_C3e-1957133177MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_B3e-1957133177MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_A3e-1957133177MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1tqe_S6e-1957137282Myocyte-specific enhancer factor 2B
1tqe_R6e-1957137282Myocyte-specific enhancer factor 2B
1tqe_Q6e-1957137282Myocyte-specific enhancer factor 2B
1tqe_P6e-1957137282Myocyte-specific enhancer factor 2B
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Sbi.111300.0ovary
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankMZEZAG1A0.0L18924.1 Corn ZAG1 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001105321.11e-180homologue of Arabidopsis gene AGAMOUS
SwissprotQ2V0P11e-124MAD58_ORYSJ; MADS-box transcription factor 58
TrEMBLQ418761e-180Q41876_MAIZE; Uncharacterized protein
STRINGSb09g006360.10.0(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP64937144
Representative plantOGRP1617761
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G18960.15e-89MIKC_MADS family protein